PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001554G0310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family HSF
Protein Properties Length: 289aa    MW: 31461.7 Da    PI: 7.8194
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001554G0310genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind70.63.1e-222482260
                     HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
     HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                     Fl+k+++++e+++++e+isw e+g+sfvv+++ e+a+++Lp +Fkh nf+SFvRQLn+Y
  PH01001554G0310 24 FLTKTHQMVEERATDEVISWGEKGRSFVVWKPVELARDLLPLHFKHCNFSSFVRQLNTY 82
                     9********************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.9E-241983IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004157.5E-2420183IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467853.4E-202083IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000561.2E-112447IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.1E-182482IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.2E-116274IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.2E-117587IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MAAAAAAQQK GGGGGRGSGG PAPFLTKTHQ MVEERATDEV ISWGEKGRSF VVWKPVELAR  60
DLLPLHFKHC NFSSFVRQLN TYCSIAPAHT FTNAIKDLLD RVVIVIENPT ITLVPNPPRG  120
VNDEAVKFPH VFVSKSGDDP PVRECSSTVG STSASSPPRA DLTSENDQLK KDNHTLIAEL  180
AQARRHCEEL LGFLSRFLDV RELDLRLLMQ EDMRGAVGSE QRRAADQEQH GCEEKSVKLF  240
GVLLKDATRK RARCEEAAAS ERPIKMIRIG EPWVSVPSSG PARCGGGN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1hks_A7e-141782165HEAT-SHOCK TRANSCRIPTION FACTOR
1hkt_A7e-141782165HEAT-SHOCK TRANSCRIPTION FACTOR
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126173e-95CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150318.11e-105heat shock factor protein 4
SwissprotQ67TP91e-104HSFB1_ORYSJ; Heat stress transcription factor B-1
TrEMBLA0A0E0ESY91e-106A0A0E0ESY9_9ORYZ; Uncharacterized protein
STRINGGRMZM2G002131_P011e-103(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36990.12e-32heat shock factor 4